Web stats for Npicom - npicom.com
News Portal of Indonesian Community
2.03 Rating by ClearWebStats
npicom.com is 2 decades 6 years 5 months old. This website has a #1,654,778 rank in global traffic. It has a .com as an domain extension. This domain is estimated value of $ 480.00 and has a daily earning of $ 2.00. While no active threats were reported recently by users, npicom.com is SAFE to browse.
Traffic Report of Npicom
Daily Unique Visitors: | 291 |
Daily Pageviews: | 582 |
Estimated Valuation
Income Per Day: | $ 2.00 |
Estimated Worth: | $ 480.00 |
Search Engine Indexes
Google Indexed Pages: | 6,100 |
Yahoo Indexed Pages: | Not Applicable |
Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
Google Backlinks: | Not Applicable |
Bing Backlinks: | Not Applicable |
Alexa BackLinks: | Not Applicable |
Safety Information
Google Safe Browsing: | No Risk Issues |
Siteadvisor Rating: | No Risk Issues |
WOT Trustworthiness: | Not Applicable |
WOT Privacy: | Not Applicable |
WOT Child Safety: | Not Applicable |
Website Ranks & Scores
Google Pagerank: | Not Applicable |
Alexa Rank: | 1,654,778 |
Domain Authority: | 22 ON 100 |
Google Pagerank
PR 0 out of 10
PageSpeed Score
72
Siteadvisor Rating
No Risk Issues
Where is npicom.com server located?
Social Engagement
Facebook Shares: | 8 |
Facebook Likes: | 7 |
Facebook Comments: | Not Applicable |
Twitter Count (Tweets): | 8 |
Linkedin Shares: | Not Applicable |
Delicious Shares: | Not Applicable |
Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
H1 Headings: | 15 | H2 Headings: | Not Applicable |
H3 Headings: | Not Applicable | H4 Headings: | 2 |
H5 Headings: | Not Applicable | H6 Headings: | Not Applicable |
Total IFRAMEs: | Not Applicable | Total Images: | 10 |
Google Adsense: | Not Applicable | Google Analytics: | UA-61554218-3 |
Websites Hosted on Same IP (i.e. 198.252.101.221)
HỘP MỰC MÁY IN, CARDTRIDGE CHÍNH HÃNG, BH 12 THÁNG
- hopmucmayin.com
Thành Đạt - Chuyên phân phối, bán buôn, bán lẻ hộp mực máy in chính hãng với giá rẻ nhất. Liên hệ đặt mua hộp mực máy in Hotline: 0965.83.83.22
Komunitas Pengusaha Muda dan Sukses – – YoungAndSuccess.ID
- youngandsuccess.com
INFO BIG NEWS
- infobignews.com
Informasi terbaru tentang masakan, kesehatan, kecantikan, laptop, smartphone, pariwisata, mobil, dan motor
KANG DADANG OFFICIAL SITE - Sampaikan walaupun hanya satu ayat
- kangdadang.com
Sampaikan walaupun hanya satu ayat
HTTP Header Analysis
Http-Version: 1.1
Status-Code: 200
Status: 200 OK
X-Powered-By: PHP/5.4.44
Vary: Cookie,Accept-Encoding
X-Pingback: http://npicom.com/xmlrpc.php
Content-Type: text/html; charset=UTF-8
Link:; rel=shortlink
Content-Encoding: gzip
Date: Tue, 08 Sep 2015 00:29:34 GMT
Accept-Ranges: bytes
Server: LiteSpeed
Connection: close
Status-Code: 200
Status: 200 OK
X-Powered-By: PHP/5.4.44
Vary: Cookie,Accept-Encoding
X-Pingback: http://npicom.com/xmlrpc.php
Content-Type: text/html; charset=UTF-8
Link:
Content-Encoding: gzip
Date: Tue, 08 Sep 2015 00:29:34 GMT
Accept-Ranges: bytes
Server: LiteSpeed
Connection: close
Domain Information for npicom.com
Domain Nameserver Information
DNS Record Analysis
Host | Type | TTL | Extra |
---|---|---|---|
npicom.com | A | 21599 |
IP:198.252.101.221 |
npicom.com | NS | 21599 |
Target:ns9.hawkhost.com |
npicom.com | NS | 21599 |
Target:ns10.hawkhost.com |
npicom.com | SOA | 21599 |
MNAME:ns9.hawkhost.com RNAME:server.hawkhost.com Serial:2015072205 Refresh:86400 Retry:7200 Expire:3600000 |
npicom.com | MX | 21599 |
Target:npicom.com |
Similarly Ranked Websites to Npicom
Modern Family Sweepstakes
- modernfamilynightlysweepstakes.com
Win an Awesome TV and Home Theater System courtesy of Modern Family Nightly!
Internetagentur Comwrap - Agentur für digitale Medien
- comwrap.com
Als Internetagentur entwickelt comwrap Online-Shops, Websites und Communities, Kampagnen für Internet und Mobile. Internetagentur Comwrap - belebt Ihr Geschäft!